PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G07700.1
Common NameAtMYB76, HAG2, MBK20.16, MYB76
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 338aa    MW: 38194.4 Da    PI: 5.1711
Description myb domain protein 76
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G07700.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.2e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEd++l+ +++ +G g W+ I+++ g++R++k+c++rw +yl
      AT5G07700.1 14 KGAWTTEEDKKLISYIHDHGEGGWRDIPEKAGLKRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding46.86.9e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++ eE+++++ +++  G++ W+ Iar+++ +Rt++++k++w+++l
      AT5G07700.1  67 RGEFSYEEEQIIIMLHASRGNK-WSVIARHLP-KRTDNEVKNYWNTHL 112
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-23864IPR009057Homeodomain-like
PROSITE profilePS5129424.084965IPR017930Myb domain
SuperFamilySSF466892.36E-2811108IPR009057Homeodomain-like
SMARTSM007172.6E-141363IPR001005SANT/Myb domain
PfamPF002491.1E-161461IPR001005SANT/Myb domain
CDDcd001674.77E-111661No hitNo description
Gene3DG3DSA:1.10.10.605.1E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129418.77666116IPR017930Myb domain
SMARTSM007172.2E-1366114IPR001005SANT/Myb domain
PfamPF002491.9E-1367112IPR001005SANT/Myb domain
CDDcd001677.18E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009414Biological Processresponse to water deprivation
GO:0009611Biological Processresponse to wounding
GO:0009625Biological Processresponse to insect
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009046anatomyflower
PO:0020100anatomyhypocotyl
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MSKRPYCIGE GLKKGAWTTE EDKKLISYIH DHGEGGWRDI PEKAGLKRCG KSCRLRWTNY  60
LKPDIKRGEF SYEEEQIIIM LHASRGNKWS VIARHLPKRT DNEVKNYWNT HLKKRLIDDG  120
IDPVTHKPLA SSNPNPVEPM KFDFQKKSNQ DEHSSQSSST TPASLPLSSN LNSVKSKISS  180
GETQIESGHV SCKKRFGRSS STSRLLNKVA ARASSIGNIL STSIEGTLRS PASSSGLPDS  240
FSQSYEYMID NKEDLGTSID LNIPEYDFPQ FLEQLINDDD ENENIVGPEQ DLLMSDFPST  300
FVDEDDILGD ITSWSTYLLD HPNFMYESDQ DSDEKNFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO58233160.0
Genevisible250589_at0.0
Expression AtlasAT5G07700-
AtGenExpressAT5G07700-
ATTED-IIAT5G07700-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Primarily present around the midvein in seedlings. Accumulates gradually in expanding leaves, reaching a maximum in fully expanded leaves in both primary and secondary veins. {ECO:0000269|PubMed:18042203}.
UniprotTISSUE SPECIFICITY: Expressed in both vegetative and generative organs. Mostly present in inflorescences, flowers and seedlings, in the transition zone between roots and the foliar part, and stems, and, to a lower extent, in leaves (in midvein and trichomes). {ECO:0000269|PubMed:18042203, ECO:0000269|PubMed:23115560}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB76).
UniProtPlays a role in determining the spatial distribution of aliphatic glucosinolates (AGLSs) within the leaf, mostly short chained. Together with MYB28/HAG1 and MYB29/HAG3, promotes aliphatic glucosinolate biosynthesis and represses indolic glucosinolate biosynthesis, but could not activate AGSL biosynthesis on its own. {ECO:0000269|PubMed:18042203, ECO:0000269|PubMed:20348214, ECO:0000269|PubMed:23792303, ECO:0000269|PubMed:23943862}.
Function -- GeneRIF ? help Back to Top
  1. HAG1/MYB28, HAG2/MYB76 and HAG3/MYB29 reciprocally transactivated each other in the control of aliphatic glucosinolate biosynthesis and downregulated the expression of genes involved in the control of indolic glucosinolate biosynthesis.
    [PMID: 18042203]
  2. not dependent on MYB28 and MYB29 for induction of aliphatic glucosinolates, plays a role in determining the spatial distribution of aliphatic glucosinolates within the leaf
    [PMID: 20348214]
  3. MYB28 expression was induced by sulfur deficiency, while the expression levels of MYB29 and MYB76 were positively correlated with sulfur concentration.
    [PMID: 23792303]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G07700.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Slightly induced by auxin (IAA) and jasmonic acid (JA). Accumulates upon mechanical stimuli (e.g. wounding) in inflorescence. Down-regulated by sulfur-deficient stress. {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18042203, ECO:0000269|PubMed:23792303}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT5G23010(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDauxin, jasmonic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G46760, AT5G46830, AT1G32640
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G07700
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1759920.0AF175992.1 Arabidopsis thaliana putative transcription factor (MYB76) mRNA, complete cds.
GenBankDQ4469300.0DQ446930.1 Arabidopsis thaliana clone pENTR221-At5g07700 myb family transcription factor (At5g07700) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196387.10.0myb domain protein 76
SwissprotQ9SPG50.0MYB76_ARATH; Transcription factor MYB76
TrEMBLA0A0F6QGB70.0A0A0F6QGB7_BRAOA; MYB76
STRINGAT5G07700.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM37871860
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  4. Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P
    Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
    Plant Biotechnol. J., 2006. 4(3): p. 317-24
    [PMID:17147637]
  5. Gigolashvili T,Engqvist M,Yatusevich R,Müller C,Flügge UI
    HAG2/MYB76 and HAG3/MYB29 exert a specific and coordinated control on the regulation of aliphatic glucosinolate biosynthesis in Arabidopsis thaliana.
    New Phytol., 2008. 177(3): p. 627-42
    [PMID:18042203]
  6. S
    A systems biology approach identifies a R2R3 MYB gene subfamily with distinct and overlapping functions in regulation of aliphatic glucosinolates.
    PLoS ONE, 2007. 2(12): p. e1322
    [PMID:18094747]
  7. Malitsky S, et al.
    The transcript and metabolite networks affected by the two clades of Arabidopsis glucosinolate biosynthesis regulators.
    Plant Physiol., 2008. 148(4): p. 2021-49
    [PMID:18829985]
  8. S
    A complex interplay of three R2R3 MYB transcription factors determines the profile of aliphatic glucosinolates in Arabidopsis.
    Plant Physiol., 2010. 153(1): p. 348-63
    [PMID:20348214]
  9. Stotz HU, et al.
    Role of camalexin, indole glucosinolates, and side chain modification of glucosinolate-derived isothiocyanates in defense of Arabidopsis against Sclerotinia sclerotiorum.
    Plant J., 2011. 67(1): p. 81-93
    [PMID:21418358]
  10. Frerigmann H,B
    Glucosinolates are produced in trichomes of Arabidopsis thaliana.
    Front Plant Sci, 2012. 3: p. 242
    [PMID:23115560]
  11. Mewis I,Khan MA,Glawischnig E,Schreiner M,Ulrichs C
    Water stress and aphid feeding differentially influence metabolite composition in Arabidopsis thaliana (L.).
    PLoS ONE, 2012. 7(11): p. e48661
    [PMID:23144921]
  12. Li Y, et al.
    Novel insights into the function of Arabidopsis R2R3-MYB transcription factors regulating aliphatic glucosinolate biosynthesis.
    Plant Cell Physiol., 2013. 54(8): p. 1335-44
    [PMID:23792303]
  13. Schweizer F, et al.
    Arabidopsis basic helix-loop-helix transcription factors MYC2, MYC3, and MYC4 regulate glucosinolate biosynthesis, insect performance, and feeding behavior.
    Plant Cell, 2013. 25(8): p. 3117-32
    [PMID:23943862]
  14. Frerigmann H,Berger B,Gigolashvili T
    bHLH05 is an interaction partner of MYB51 and a novel regulator of glucosinolate biosynthesis in Arabidopsis.
    Plant Physiol., 2014. 166(1): p. 349-69
    [PMID:25049362]
  15. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  16. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]